TB-500
Peptide for improving muscle and tissue recovery. Reduces inflammation and promotes cell renewal.
Select Size
Select Bundle
Compound
TB-500
Form
Lyophilized Powder
Purity
>99%
Storage
-20°C
Science
Mechanism of Action
TB-500 is a synthetic fraction of Thymosin Beta-4, a naturally occurring 43-amino acid peptide. It promotes cellular migration, angiogenesis, and tissue repair by upregulating actin sequestration and cell-building proteins. It plays a critical role in wound healing, muscle recovery, and cardiovascular repair.
Benefits
Research Benefits
- Accelerated wound healing and tissue repair
- Enhanced muscle recovery and reduced inflammation
- Promotes new blood vessel formation (angiogenesis)
- Cardioprotective effects following cardiac injury
- Improved flexibility and reduced scar tissue formation
- Neuroprotective and anti-inflammatory properties
Research
Dosage Protocol
Research protocols typically use 2-5mg administered subcutaneously twice weekly for 4-6 weeks, followed by a maintenance phase of 1-2mg monthly. Dosing varies based on research model and application.
Technical Specifications
Research Comparison
Compare Specs Side-by-Side
| Peptide | ||
|---|---|---|
| Aliases | Thymosin Beta-4 | |
| CAS Number | 77591-33-4 | |
| Molecular Weight | 4963.44 g/mol | |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | |
| Purity | >99% (HPLC) | |
| Form | Lyophilized Powder | |
| Storage | -20°C | |
| Price | £35 | |
| Mechanism | TB-500 is a synthetic fraction of Thymosin Beta-4, a naturally occurring 43-amino acid peptide. It promotes cellular migration, angiogenesis, and tissue repair by upregulating actin sequestration and cell-building proteins. It plays a critical role in wound healing, muscle recovery, and cardiovascular repair. | |
| Dosage Protocol | Research protocols typically use 2-5mg administered subcutaneously twice weekly for 4-6 weeks, followed by a maintenance phase of 1-2mg monthly. Dosing varies based on research model and application. |
Comparison for research purposes only · All peptides >99% HPLC-verified purity
Stability
Storage Guidelines
Store lyophilized powder at -20°C. Reconstituted solution stable at 2-8°C for up to 30 days. Keep away from direct sunlight.
Safety
Safety & Effects
TB-500 has demonstrated a favorable safety profile in preclinical studies. Some research models reported mild fatigue or injection site reactions. No serious adverse effects documented at therapeutic doses.
Scientific Literature
Published Research
Nature, 2004
Thymosin Beta-4 in Cardiac Repair
Promotes cardiac repair after myocardial infarction
PubMed →Annals of the New York Academy of Sciences, 2010
Thymosin Beta-4 and Wound Healing
Accelerates wound healing and tissue regeneration
PubMed →FASEB Journal, 2006
Thymosin Beta-4 Promotes Angiogenesis
Stimulates endothelial cell migration and tube formation
PubMed →Research Tool
Peptide Reconstitution Calculator
Calculate precise dosing with a visual syringe ruler
Visual Reconstitution Calculator
Select your parameters and get precise instructions with a visual syringe ruler
What is the total volume of your syringe?
What is your peptide vial quantity?
How much bacteriostatic water are you adding?
What is the dose?
For a dose of 20 units pull the syringe to 20
Units to Draw
20 U
Volume
0.200 ml
Concentration
50 mcg/U
Total Doses
10
Research use only · Not for human consumption
Related Products
Shopping Cart
(0)Your cart is empty